World’s first comprehensive online database on Curcumin

CRDB_MT00017


Beta lactamase [Pseudomonas aeruginosa]

CRDB IDCRDB_MT00017
NCBI114881106
NCBI (Gene) 4290808
CCDSNA
HGNCNA
HPRDNA
MIM NA
Uniprot Q932Y6
RCSB PDB ID NA
DrugBank NA
Protein Sequence >gi|114881106 MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRPEERFPMMSTF KVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTI GGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWME ADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGA SLIKHW
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 NA NA 624371 NA
99844 NA NA 624371 NA
969516 IC50 7.751 588341, 1556, 624371 NA
1550234 NA NA 1527 NA
5324476 IC50 8.095 588341, 624371 NA
Disease Targets

Bacterial infections [PMID:11417732]