World’s first comprehensive online database on Curcumin

CRDB_MT00023


Carbonic anhydrase 1 [Homo sapiens]

CRDB IDCRDB_MT00023
NCBI115449
NCBI (Gene)759
CCDSNA
HGNC1368
HPRDNA
MIM 114800
Uniprot P00915
RCSB PDB ID 1AZM 1BZM 1CRM 1CZM 1HCB 1HUG 1HUH 1J9W 1JV0 2CAB 2FOY 2FW4 2IT4 2NMX 2NN1 2NN7 3LXE
DrugBank DB00232, DB00311, DB00381, DB00436, DB00562, DB00606, DB00661, DB00703, DB00774, DB00819, DB00880, DB00909, DB00999, DB01021, DB01031, DB01119, DB01144, DB01194, DB01202, DB01325
Protein Sequence>gi|115449 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 2.41 501903 20674354
Disease Targets

Glaucoma [PMID:11342280];

Hypertension [PMID:11101200];

Pancreatic cancer [PMID:11101200]