World’s first comprehensive online database on Curcumin

CRDB_MT00030


Carbonic anhydrase 4 [Homo sapiens]

CRDB IDCRDB_MT00030
NCBI115465
NCBI (Gene)762
CCDSNA
HGNC1375
HPRDNA
MIM 600852 , 114760
Uniprot P22748 P22748
RCSB PDB ID 1ZNC 3F7B 3F7U 3FW3
DrugBank DB00232 DB01325 DB01119 DB01021 DB00999 DB00880 DB00774 DB00606 DB00562 DB00436 DB00273
Protein Sequence>gi|115465 MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF FFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMH IVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT VIKSGAPGRPLPWALPALLGPMLACLLAGFLR
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 4.97 501906 20674354
Disease Targets

Glaucoma [PMID:11342280];

Pancreatic cancer [PMID:10231836];

Renal failure [PMID:12027223];

Salivary glands cancer [PMID:10231836]