World’s first comprehensive online database on Curcumin

CRDB_MT00008


Alkaline phosphatase, tissue-nonspecific isozyme isoform 1 precursor [Homo sapiens]

CRDB IDCRDB_MT00008
NCBI116734717
NCBI (Gene)249
CCDSCCDS217.1
HGNC438
HPRDNA
MIM 171760
Uniprot P05186
RCSB PDB ID NA
DrugBank DB01143
Protein Sequence>gi|116734717 MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
969516 1135
Disease Targets

Cancer [PMID:19555389]