World’s first comprehensive online database on Curcumin

CRDB_MT00015


APOBEC3G gene product [Homo sapiens]

CRDB IDCRDB_MT00015
NCBI13399304
NCBI (Gene) 60489
CCDSCCDS13984.1
HGNC 17357
HPRD 06172
MIM 607113
Uniprot Q9HC16
RCSB PDB ID 2JYW 2KBO 3E1U 3IQS 3IR2 3V4J 3V4K
DrugBank NA
Protein Sequence>gi|13399304 MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRF FHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQ KRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEP WVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVT CFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5703486 Potency 8.8612 651813 NA
Disease Targets

Antiviral [AID:651813]