World’s first comprehensive online database on Curcumin

CRDB_MT00029


Carbonic anhydrase 3 [Homo sapiens]

CRDB IDCRDB_MT00029
NCBI134047703
NCBI (Gene)761
CCDSNA
HGNC 1374
HPRDNA
MIM 114750
Uniprot P07451
RCSB PDB ID 1Z93 1Z97 2HFW 3UYN 3UYQ
DrugBank NA
Protein Sequence>gi|134047703 MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVF DDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGI AVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLL LKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 11.3 501905 20674354
Disease Targets

Glaucoma, tumor, obesity [PMID:17504127]