World’s first comprehensive online database on Curcumin

CRDB_MT00007


Alkaline phosphatase, placental-like preproprotein [Homo sapiens]

CRDB IDCRDB_MT00007
NCBI157266296
NCBI (Gene)251
CCDSCCDS2491.1
HGNC441
HPRDNA
MIM 171810
Uniprot P10696
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|157266296 MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC NTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY TACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 IC50 63.5 488879
Disease Targets

Data not available.