World’s first comprehensive online database on Curcumin

CRDB_MT00014


APOBEC3F gene product [Homo sapiens]

CRDB IDCRDB_MT00014
NCBI22907044
NCBI (Gene)200316
CCDSCCDS33648.1
HGNC17356
HPRD 16415
MIM 608993
Uniprot Q8IUX4
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|22907044 MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCF LSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQA GARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKA YGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPC PECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEP FKPWKGLKYNFLFLDSKLQEILE
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5703486 Potency 14.0441 651814 NA
Disease Targets

Antiviral [AID:651814]