World’s first comprehensive online database on Curcumin

CRDB_MT00010


Alternatively spliced Trp4 [Mus musculus]

CRDB IDCRDB_MT00010
NCBI2935630
NCBI (Gene)NA
CCDSNA
HGNCNA
HPRDNA
MIM
Uniprot Q9QUQ5
RCSB PDB ID
DrugBank
Protein Sequence>gi|2935630 MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLG RTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFT PDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIA LSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEE QSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIA PKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEALFAIANIFSSL RLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNA FSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADH ADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTHLCKKKMRRKPESFGTIGRRAADNL RRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLSTIQSANAASS ADSDEKSQSEEEITRQQAAGALERNIELESKGLASRGDRSIPGLNEQCVLVDHRERNTDTLGLQVGKRVC STFKSEKVVVEDTVPIIPKEKHAHEEDSSIDYDLSPTDTAAHEDYVTTRL
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
969516 NA NA 2237 NA
1550234 NA NA 2247 NA
6477637 NA NA 2237 NA
Disease Targets

Neuropathic pain [PMID:19116627]; Cardiovascular diseases [PMID:19234573]