World’s first comprehensive online database on Curcumin

CRDB_MT00025


Carbonic anhydrase 13 [Homo sapiens]

CRDB IDCRDB_MT00025
NCBI30580350
NCBI (Gene) 377677
CCDSNA
HGNC14914
HPRDNA
MIM 611436
Uniprot Q8N1Q1
RCSB PDB ID 3CZV 3D0N 3DA2
DrugBank NA
Protein Sequence>gi|30580350 MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 6.85 501913 20674354
Disease Targets

Glaucoma, tumor, obesity [PMID:17504127]