World’s first comprehensive online database on Curcumin

CRDB_MT00027


Carbonic anhydrase 15 [Mus musculus]

CRDB IDCRDB_MT00027
NCBI30580362
NCBI (Gene)80733
CCDSNA
HGNC
HPRD
MIM NA
Uniprot Q99N23
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|30580362 MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRLVQRDYTLKPF IFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQLHFHWGSPGHQGSEHSLDEK HGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDRDNTNFSAIVSGLKNLSSPGVAVNLTSTFAL ASLLPSALRLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRP QQPLGGRRISASPEASVRSSVSTLPCLHLALVGLGVGLRLWQGP
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 5.09 501915 20674354
Disease Targets

Glaucoma, tumor, obesity [PMID:17504127]