World’s first comprehensive online database on Curcumin

CRDB_MT00005


Aldehyde dehydrogenase 1 family, member A1 [Homo sapiens]

CRDB IDCRDB_MT00005
NCBI30582681
NCBI (Gene)NA
CCDSNA
HGNCNA
HPRDNA
MIM NA
Uniprot P00352
RCSB PDB ID NA
DrugBank DB00157 DB00162 DB00755
Protein Sequence>gi|30582681 MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK TVTVKISQKNS
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
969516 Potency 8.9125 1030 NA
Disease Targets

Obesity [AID:1030]