World’s first comprehensive online database on Curcumin

CRDB_MT00004


ABHD5 gene product [Homo sapiens]

CRDB IDCRDB_MT00004
NCBI31542303
NCBI (Gene)51099
CCDSCCDS2711.1
HGNC21396
HPRD11986
MIM 604780
Uniprot Q8WTS1
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|31542303 MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
99844 NA NA 602281, 651612 NA
969516 IC50 9.157 504317, 493027, 602281 NA
5703486 NA NA 602281, 651612 NA
5714141 IC50 5.24 504319, 504317, 493027, 493035, 602281, 651612 NA
5898023 NA NA 602281, 602399 NA
6477637 NA NA 602281, 651612 NA
Disease Targets

Diabetes [PMID:18996284]; Atherosclerosis, heart muscle disease [PMID:11943743]