World’s first comprehensive online database on Curcumin

CRDB_MT00001


15-hydroxyprostaglandin dehydrogenase [NAD+] isoform 1 [Homo sapiens]

CRDB IDCRDB_MT00001
NCBI31542939
NCBI (Gene)3248
CCDSCCDS3821.1
HGNC5154
HPRD03406
MIM 601688
Uniprot P15428
RCSB PDB ID 2GDZ
DrugBank DB00157
Protein Sequence>gi|31542939 MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Potency 14.1254 894 NA
969516 Potency 22.3872 894 NA
Disease Targets

Cancer [PMID:21856294]