World’s first comprehensive online database on Curcumin

CRDB_MT00012


Anoctamin-1 isoform 1 [Mus musculus]

CRDB IDCRDB_MT00012
NCBI334278898
NCBI (Gene)101772
CCDSCCDS40202.1
HGNCNA
HPRDNA
MIM NA
Uniprot Q8BHY3
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|334278898 MQDAQDSDIGLEGLTPEGTSADRECQRGPETIAHEAQDAGTPNSDATGVVDGEREATMRVPEKYSTLPAE DRSVHIVNICAIEDLGYLPSEGTLLNSLSVDPDAECKYGLYFRDGKRKVDYILVYHHKRASGSRTLARRG LQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGV GFVKIHAPWHVLCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYP FSREKQHLFDLTDRDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYSAAYPLHDGDYEGDNV EFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDEN IPSMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMR LNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESRNKETDKVKLTWRDRFPAYFTNLVSIIFMIAV TFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTE KSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIML GKQLIQNNLFEIGIPKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMIIQFGFV TLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTS DFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDI SKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQGKQQLLDTWM EKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
6477637 NA NA 623877 NA
Disease Targets

Cystic fibrosis, asthma, chronic bronchitis, and hypertension [AID:623877]