World’s first comprehensive online database on Curcumin

CRDB_MT00018


Beta-2 adrenergic receptor [Homo sapiens]

CRDB IDCRDB_MT00018
NCBI4501969
NCBI (Gene)154
CCDSCCDS4292.1
HGNC 286
HPRD00187
MIM 109690
Uniprot P07550
RCSB PDB ID 1GQ4 2R4R 2R4S 2RH1 3D4S 3KJ6 3NY8 3NY9 3NYA 3P0G 3PDS 3SN6 4GBR
DrugBank DB00368 DB00373 DB00521 DB00571 DB00598 DB00612 DB00668 DB00816 DB00852 DB00866 DB00867 DB00871 DB00901 DB00938 DB00960 DB00983 DB01001 DB01064 DB01136 DB01151 DB01158 DB01203 DB01210 DB01214 DB01274 DB01288 DB01291 DB01359 DB01366 DB01407 DB01408 DB01580
Protein Sequence>gi|4501969 MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMG TFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAY GNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
1550234 504454
Disease Targets

Anxiety disorder [PMID:9551698];

Asthma [PMID:8723736,2991865];

Cardiac arrhythmias [PMID:9551698];

Chronic obstructive pulmonary disease, unspecified [PMID:12137617, 10796594];

Depression [PMID:10618463]; Glaucoma [PMID:2907563];

Hypertension [PMID:95516987662225]; Inflammation [PMID:12392033,1349257];

Multiple sclerosis [PMID:11772115]; Obstructive airway disease [PMID:239414];

Respiratory distress syndrome [PMID:2878809];

Skeletal muscle wasting [PMID:12388476];

Skeletal muscle weakness [PMID:12388476]