World’s first comprehensive online database on Curcumin

CRDB_MT00013


APLNR gene product [Homo sapiens]

CRDB IDCRDB_MT00013
NCBI4885057
NCBI (Gene)187
CCDSCCDS7950.1
HGNC339
HPRD02503
MIM 600052
Uniprot B2RDH3 B3KQN4 P35414
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|4885057 MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH SQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
969516 NA NA 2521, 2766 NA
1550234 NA NA 2521, 2766 NA
5703486 NA NA 2521 NA
Disease Targets

Abdominal aortic aneurysms [AID:2521]