World’s first comprehensive online database on Curcumin

CRDB_MT00024


Carbonic anhydrase 12 [Homo sapiens]

CRDB IDCRDB_MT00024
NCBI5915866
NCBI (Gene)771
CCDSNA
HGNC1371
HPRDNA
MIM 143860 603263
Uniprot O43570
RCSB PDB ID 1JCZ 1JD0
DrugBank DB00819
Protein Sequence>gi|5915866 MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET EAHA
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 3.48 501912 20674354
Disease Targets

Colorectal cancer [PMID:11083462];

Gastrointestinal cancers [PMID:11083462];

Pancreatic cancer [PMID:11083462];

Renal failure [PMID:12027223]