World’s first comprehensive online database on Curcumin

CRDB_MT00022


BZLF1 [Human herpesvirus 4]

CRDB IDCRDB_MT00022
NCBI82503229
NCBI (Gene)3783744
CCDSNA
HGNCNA
HPRDNA
MIM
Uniprot
RCSB PDB ID 1ZSD 2AK4 2AXF 2AXG 2C9L 2C9N 3KWW 3KXF 3SPV 3VFN 3VFO 3VFP 3VFR
DrugBank NA
Protein Sequence>gi|82503229 MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSTAP TGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNSTVQTAAAVVFACPGANQGQQ LADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSE NDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5703486 NA NA 2234, 2361 NA
5281767 NA NA 2234 NA
Disease Targets

Burkitt’s lymphoma and Hodgkin’s disease [PMID:15242681|15242681];

Multiple sclerosis [PMID:17459939];

Lupus [PMID:17153849];

Infectious mononucleosis [PMID:15541197];

Nasopharyngeal carcinoma [PMID:12450729]