World’s first comprehensive online database on Curcumin

CRDB_MT00002


5-hydroxytryptamine receptor 7 [Homo sapiens]

CRDB IDCRDB_MT00002
NCBI8488960
NCBI (Gene)3363
CCDSNA
HGNC5302
HPRDNA
MIM 182137
Uniprot P34969
RCSB PDB ID NA
DrugBank DB00246 DB00247 DB00216
Protein Sequence>gi|8488960 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGC GEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSV TDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLS ASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPR VEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
637308 IC50 47.6 380792 16643021
Disease Targets

Migraine [PMID:11937086, 12349912 ]; Neuropsychiatric disorders [PMID:14965246]