World’s first comprehensive online database on Curcumin

CRDB_MT00026


Carbonic anhydrase 14 [Homo sapiens]

CRDB IDCRDB_MT00026
NCBI8928036
NCBI (Gene)23632
CCDSNA
HGNC1372
HPRDNA
MIM 604832
Uniprot Q9ULX7
RCSB PDB ID NA
DrugBank NA
Protein Sequence>gi|8928036 MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Download Fasta

Active Curcumin Derivatives

PubChem Compound ID Activity Name Concentration[uM] PubChem Bioassay ID PubMed ID
5281767 Ki 11.73 501914 20674354
Disease Targets

Renal failure [PMID:12028451]